Lineage for d1s3ja_ (1s3j A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438919Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 438940Protein Putative transcriptional regulator YusO [101012] (1 species)
  7. 438941Species Bacillus subtilis [TaxId:1423] [101013] (1 PDB entry)
  8. 438942Domain d1s3ja_: 1s3j A: [98437]

Details for d1s3ja_

PDB Entry: 1s3j (more details), 2.25 Å

PDB Description: X-ray crystal structure of YusO protein from Bacillus subtilis

SCOP Domain Sequences for d1s3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis}
sadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerme
vkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimarylsf
lteeemlqaahitaklaqaaetd

SCOP Domain Coordinates for d1s3ja_:

Click to download the PDB-style file with coordinates for d1s3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1s3ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s3jb_