Lineage for d1s3ia1 (1s3i A:204-307)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376020Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 376021Superfamily b.46.1: FMT C-terminal domain-like [50486] (2 families) (S)
  5. 376022Family b.46.1.1: Post formyltransferase domain [50487] (2 proteins)
  6. 376023Protein 10-formyltetrahydrofolate dehydrogenase domain 2 [101807] (1 species)
  7. 376024Species Rat (Rattus norvegicus) [TaxId:10116] [101808] (1 PDB entry)
  8. 376025Domain d1s3ia1: 1s3i A:204-307 [98435]
    Other proteins in same PDB: d1s3ia2
    complexed with bme; mutant

Details for d1s3ia1

PDB Entry: 1s3i (more details), 2.3 Å

PDB Description: crystal structure of the n terminal hydrolase domain of 10- formyltetrahydrofolate dehydrogenase

SCOP Domain Sequences for d1s3ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ia1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Rat (Rattus norvegicus)}
qkketakinwdqpaeaihnwirgndkvpgawteacgqkltffnstlntsglstqgealpi
pgahrpgvvtkaglilfgnddrmllvkniqledgkmmpasqffk

SCOP Domain Coordinates for d1s3ia1:

Click to download the PDB-style file with coordinates for d1s3ia1.
(The format of our PDB-style files is described here.)

Timeline for d1s3ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s3ia2