Lineage for d1s3ga2 (1s3g A:126-160)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524137Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 524138Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 524139Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 524140Species Bacillus globisporus [TaxId:1459] [103619] (1 PDB entry)
  8. 524141Domain d1s3ga2: 1s3g A:126-160 [98434]
    Other proteins in same PDB: d1s3ga1

Details for d1s3ga2

PDB Entry: 1s3g (more details), 2.25 Å

PDB Description: Crystal structure of adenylate kinase from Bacillus globisporus

SCOP Domain Sequences for d1s3ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus}
grrickvcgtsyhllfnppqvegkcdkdggelyqr

SCOP Domain Coordinates for d1s3ga2:

Click to download the PDB-style file with coordinates for d1s3ga2.
(The format of our PDB-style files is described here.)

Timeline for d1s3ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s3ga1