SCOP 1.69: Domain d1s3ga2: 1s3g A:126-160

Lineage for d1s3ga2 (1s3g A:126-160)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Bacillus globisporus [TaxId:1459] [103619] (1 PDB entry)

8. Domain d1s3ga2: 1s3g A:126-160 [98434]
   Other proteins in same PDB: d1s3ga1

Details for d1s3ga2

PDB Entry: 1s3g, 2.25 Å

PDB Description: Crystal structure of adenylate kinase from Bacillus globisporus

SCOP Domain Sequences for d1s3ga2:

Sequence; same for both SEQRES and ATOM records:

>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus}
grrickvcgtsyhllfnppqvegkcdkdggelyqr

Timeline for d1s3ga2:

• d1s3ga2 first appeared in SCOP 1.67
  
• d1s3ga2 appears in SCOP 1.71
  
• d1s3ga2 appears in the current release, SCOPe 2.08