![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins) |
![]() | Protein Purine transdeoxyribosylase [102244] (1 species) class I N-deoxyribosyltransferase |
![]() | Species Lactobacillus helveticus [TaxId:1587] [102245] (6 PDB entries) |
![]() | Domain d1s3fb_: 1s3f B: [98431] complexed with sni |
PDB Entry: 1s3f (more details), 2.2 Å
SCOPe Domain Sequences for d1s3fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3fb_ c.23.14.1 (B:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]} mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy
Timeline for d1s3fb_: