Lineage for d1s3fb_ (1s3f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858402Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 2858420Protein Purine transdeoxyribosylase [102244] (1 species)
    class I N-deoxyribosyltransferase
  7. 2858421Species Lactobacillus helveticus [TaxId:1587] [102245] (6 PDB entries)
  8. 2858435Domain d1s3fb_: 1s3f B: [98431]
    complexed with sni

Details for d1s3fb_

PDB Entry: 1s3f (more details), 2.2 Å

PDB Description: Purine 2'-deoxyribosyltransferase + selenoinosine
PDB Compounds: (B:) purine trans deoxyribosylase

SCOPe Domain Sequences for d1s3fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3fb_ c.23.14.1 (B:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]}
mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig
girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh
pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy

SCOPe Domain Coordinates for d1s3fb_:

Click to download the PDB-style file with coordinates for d1s3fb_.
(The format of our PDB-style files is described here.)

Timeline for d1s3fb_: