Lineage for d1s32d_ (1s32 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535113Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 535114Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 535115Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 535171Protein Histone H2B [47119] (3 species)
  7. 535172Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)
  8. 535175Domain d1s32d_: 1s32 D: [98415]
    Other proteins in same PDB: d1s32a_, d1s32b_, d1s32c_, d1s32e_, d1s32f_, d1s32g_

Details for d1s32d_

PDB Entry: 1s32 (more details), 2.05 Å

PDB Description: molecular recognition of the nucleosomal 'supergroove'

SCOP Domain Sequences for d1s32d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s32d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
dgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahyn
krstitsreiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1s32d_:

Click to download the PDB-style file with coordinates for d1s32d_.
(The format of our PDB-style files is described here.)

Timeline for d1s32d_: