Class a: All alpha proteins [46456] (218 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (3 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries) |
Domain d1s32d_: 1s32 D: [98415] Other proteins in same PDB: d1s32a_, d1s32b_, d1s32c_, d1s32e_, d1s32f_, d1s32g_ |
PDB Entry: 1s32 (more details), 2.05 Å
SCOP Domain Sequences for d1s32d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s32d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)} dgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahyn krstitsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1s32d_: