Lineage for d1s2ub_ (1s2u B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476105Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
    forms a swapped dimer
  6. 476140Protein Phosphoenolpyruvate mutase [51636] (1 species)
  7. 476141Species Blue mussel (Mytilus edulis) [TaxId:6550] [51637] (6 PDB entries)
  8. 476148Domain d1s2ub_: 1s2u B: [98402]

Details for d1s2ub_

PDB Entry: 1s2u (more details), 2 Å

PDB Description: crystal structure of the d58a phosphoenolpyruvate mutase mutant protein

SCOP Domain Sequences for d1s2ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ub_ c.1.12.7 (B:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis)}
vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrasneasw
tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylp

SCOP Domain Coordinates for d1s2ub_:

Click to download the PDB-style file with coordinates for d1s2ub_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ub_: