SCOPe 2.05: Domain d1s2qa2: 1s2q A:290-401

Lineage for d1s2qa2 (1s2q A:290-401)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (37 PDB entries)

8. Domain d1s2qa2: 1s2q A:290-401 [98396]
   Other proteins in same PDB: d1s2qa1, d1s2qb1
   complexed with fad, ras

Details for d1s2qa2

PDB Entry: 1s2q, 2.07 Å

PDB Description: Crystal structure of MAOB in complex with N-propargyl-1(R)-aminoindan (Rasagiline)

PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1s2qa2:

Sequence; same for both SEQRES and ATOM records:

>d1s2qa2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d1s2qa2:

• d1s2qa2 first appeared in SCOP 1.67
  
• d1s2qa2 appears in SCOPe 2.04
  
• d1s2qa2 appears in SCOPe 2.06
  
• d1s2qa2 appears in the current release, SCOPe 2.08