Lineage for d1s2ka_ (1s2k A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044017Family b.29.1.20: Peptidase A4 [101656] (3 protein domains)
    circular permutation of the canonical fold
  6. 2044021Protein Scytalidopepsin B [101657] (1 species)
  7. 2044022Species Fungus (Scytalidium lignicola) [TaxId:5539] [101658] (2 PDB entries)
  8. 2044023Domain d1s2ka_: 1s2k A: [98389]
    complexed with tyr

Details for d1s2ka_

PDB Entry: 1s2k (more details), 2 Å

PDB Description: structure of scp-b a member of the eqolisin family of peptidases in a complex with a tripeptide ala-ile-his
PDB Compounds: (A:) Scytalidopepsin B

SCOPe Domain Sequences for d1s2ka_:

Sequence, based on SEQRES records: (download)

>d1s2ka_ b.29.1.20 (A:) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

Sequence, based on observed residues (ATOM records): (download)

>d1s2ka_ b.29.1.20 (A:) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewevsitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnessgslc
rtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqitqviin
nqdvtdcsvsgttvscsyv

SCOPe Domain Coordinates for d1s2ka_:

Click to download the PDB-style file with coordinates for d1s2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ka_: