Lineage for d1s2ic_ (1s2i C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391608Superfamily c.23.14: N-deoxyribosyltransferase [52309] (1 family) (S)
  5. 391609Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 protein domains)
  6. 391616Protein Purine transdeoxyribosylase [102244] (1 species)
    class I N-deoxyribosyltransferase
  7. 391617Species Lactobacillus helveticus [TaxId:1587] [102245] (5 PDB entries)
  8. 391629Domain d1s2ic_: 1s2i C: [98388]
    complexed with bp1

Details for d1s2ic_

PDB Entry: 1s2i (more details), 2.24 Å

PDB Description: Purine 2'deoxyribosyltransferase + bromopurine

SCOP Domain Sequences for d1s2ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ic_ c.23.14.1 (C:) Purine transdeoxyribosylase {Lactobacillus helveticus}
mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig
girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh
pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy

SCOP Domain Coordinates for d1s2ic_:

Click to download the PDB-style file with coordinates for d1s2ic_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ic_: