Lineage for d1s2ha_ (1s2h A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432422Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 1432423Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
    automatically mapped to Pfam PF02301
  5. 1432424Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)
  6. 1432425Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)
  7. 1432426Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries)
  8. 1432433Domain d1s2ha_: 1s2h A: [98385]

Details for d1s2ha_

PDB Entry: 1s2h (more details)

PDB Description: the mad2 spindle checkpoint protein possesses two distinct natively folded states
PDB Compounds: (A:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d1s2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ha_ d.135.1.1 (A:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
malqlsreqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdle
likylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreks
qkaiqdeirsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnsee
vrlrsftttihkvnsmvaykipvnd

SCOPe Domain Coordinates for d1s2ha_:

Click to download the PDB-style file with coordinates for d1s2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ha_: