Lineage for d1s2ha_ (1s2h A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418725Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 418726Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (1 family) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
  5. 418727Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (1 protein)
  6. 418728Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)
  7. 418729Species Human (Homo sapiens) [TaxId:9606] [56022] (4 PDB entries)
  8. 418736Domain d1s2ha_: 1s2h A: [98385]
    mutant

Details for d1s2ha_

PDB Entry: 1s2h (more details)

PDB Description: the mad2 spindle checkpoint protein possesses two distinct natively folded states

SCOP Domain Sequences for d1s2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ha_ d.135.1.1 (A:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens)}
malqlsreqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdle
likylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreks
qkaiqdeirsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnsee
vrlrsftttihkvnsmvaykipvnd

SCOP Domain Coordinates for d1s2ha_:

Click to download the PDB-style file with coordinates for d1s2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ha_: