![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-deoxyribosyltransferase [52309] (1 family) ![]() |
![]() | Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins) |
![]() | Protein Purine transdeoxyribosylase [102244] (1 species) class I N-deoxyribosyltransferase |
![]() | Species Lactobacillus helveticus [TaxId:1587] [102245] (5 PDB entries) |
![]() | Domain d1s2gb_: 1s2g B: [98383] |
PDB Entry: 1s2g (more details), 2.1 Å
SCOP Domain Sequences for d1s2gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2gb_ c.23.14.1 (B:) Purine transdeoxyribosylase {Lactobacillus helveticus} mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy
Timeline for d1s2gb_: