SCOPe 2.07: Domain d1s2eb_: 1s2e B:

Lineage for d1s2eb_ (1s2e B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.32: gp9 [50016] (1 superfamily)
   consists of two different beta-sandwich domains unrelated to other beta-sandwich folds

4. Superfamily b.32.1: gp9 [50017] (1 family)
   automatically mapped to Pfam PF07880

5. Family b.32.1.1: gp9 [50018] (1 protein)

6. Protein gp9 [50019] (1 species)
   the trigger of tail contraction and the long tail fibers connector

7. Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries)

8. Domain d1s2eb_: 1s2e B: [98381]
   alternative fit of the first 19 residues
   complexed with epe

Details for d1s2eb_

PDB Entry: 1s2e, 2.3 Å

PDB Description: bacteriophage t4 gene product 9 (gp9), the trigger of tail contraction and the long tail fibers connector, alternative fit of the first 19 residues

PDB Compounds: (B:) Baseplate structural protein Gp9

SCOPe Domain Sequences for d1s2eb_:

Sequence; same for both SEQRES and ATOM records:

>d1s2eb_ b.32.1.1 (B:) gp9 {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

Timeline for d1s2eb_:

• d1s2eb_ first appeared in SCOP 1.67
  
• d1s2eb_ appears in SCOPe 2.06
  
• d1s2eb_ appears in the current release, SCOPe 2.08