Lineage for d1s2ba_ (1s2b A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371999Family b.29.1.20: Peptidase A4 [101656] (1 protein)
    circular permutation of the canonical fold
  6. 372000Protein Scytalidopepsin B [101657] (1 species)
  7. 372001Species Fungus (Scytalidium lignicolum) [101658] (2 PDB entries)
  8. 372002Domain d1s2ba_: 1s2b A: [98375]

Details for d1s2ba_

PDB Entry: 1s2b (more details), 2.1 Å

PDB Description: Structure of SCP-B the first member of the Eqolisin family of Peptidases to have its structure determined

SCOP Domain Sequences for d1s2ba_:

Sequence, based on SEQRES records: (download)

>d1s2ba_ b.29.1.20 (A:) Scytalidopepsin B {Fungus (Scytalidium lignicolum)}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

Sequence, based on observed residues (ATOM records): (download)

>d1s2ba_ b.29.1.20 (A:) Scytalidopepsin B {Fungus (Scytalidium lignicolum)}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewevsitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnessgslc
rtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqitqviin
nqdvtdcsvsgttvscsyv

SCOP Domain Coordinates for d1s2ba_:

Click to download the PDB-style file with coordinates for d1s2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ba_: