Lineage for d1s29a1 (1s29 A:4-92)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307558Family a.4.5.46: La domain [101051] (2 proteins)
    Pfam PF05383; RNA-binding domain
  6. 2307562Protein Lupus La autoantigen N-terminal domain [101052] (2 species)
  7. 2307576Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [101054] (1 PDB entry)
  8. 2307577Domain d1s29a1: 1s29 A:4-92 [98373]
    Other proteins in same PDB: d1s29a2

Details for d1s29a1

PDB Entry: 1s29 (more details), 1.6 Å

PDB Description: La autoantigen N-terminal domain
PDB Compounds: (A:) La protein

SCOPe Domain Sequences for d1s29a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s29a1 a.4.5.46 (A:4-92) Lupus La autoantigen N-terminal domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mplssenkqklqkqvefyfsdvnvqrdiflkgkmaenaegfvsletlltfkrvnsvttdv
kevveairpseklvlsedglmvrrrdplp

SCOPe Domain Coordinates for d1s29a1:

Click to download the PDB-style file with coordinates for d1s29a1.
(The format of our PDB-style files is described here.)

Timeline for d1s29a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s29a2