SCOPe 2.06: Domain d1s29a1: 1s29 A:4-92

Lineage for d1s29a1 (1s29 A:4-92)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.46: La domain [101051] (2 proteins)
   Pfam PF05383; RNA-binding domain

6. Protein Lupus La autoantigen N-terminal domain [101052] (2 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [101054] (1 PDB entry)

8. Domain d1s29a1: 1s29 A:4-92 [98373]
   Other proteins in same PDB: d1s29a2

Details for d1s29a1

PDB Entry: 1s29, 1.6 Å

PDB Description: La autoantigen N-terminal domain

PDB Compounds: (A:) La protein

SCOPe Domain Sequences for d1s29a1:

Sequence; same for both SEQRES and ATOM records:

>d1s29a1 a.4.5.46 (A:4-92) Lupus La autoantigen N-terminal domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mplssenkqklqkqvefyfsdvnvqrdiflkgkmaenaegfvsletlltfkrvnsvttdv
kevveairpseklvlsedglmvrrrdplp

Timeline for d1s29a1:

• d1s29a1 first appeared in SCOP 1.67, called d1s29a_
  
• d1s29a1 was called d1s29a_ in SCOPe 2.05
  
• d1s29a1 appears in SCOPe 2.07
  
• d1s29a1 appears in the current release, SCOPe 2.08