Lineage for d1s26c_ (1s26 C:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518934Fold e.41: Adenylylcyclase toxin (the edema factor) [81299] (1 superfamily)
    3 domains: (1&2) alpha+beta, with domain 2 being inserted in domain 1; (3) all-alpha
  4. 518935Superfamily e.41.1: Adenylylcyclase toxin (the edema factor) [81298] (1 family) (S)
    Domain 1 has topological and active site similarity to the Nucleotidyltransferases (eg. 1kny N-domain); domain 3 binds calmodulin
  5. 518936Family e.41.1.1: Adenylylcyclase toxin (the edema factor) [69887] (1 protein)
    decorated with many insertions and the C-terminal domain
  6. 518937Protein Adenylylcyclase toxin (the edema factor) [69888] (1 species)
  7. 518938Species Bacillus anthracis [TaxId:1392] [69889] (7 PDB entries)
  8. 518945Domain d1s26c_: 1s26 C: [98369]
    Other proteins in same PDB: d1s26d_, d1s26e_, d1s26f_

Details for d1s26c_

PDB Entry: 1s26 (more details), 3 Å

PDB Description: structure of anthrax edema factor-calmodulin-alpha,beta- methyleneadenosine 5'-triphosphate complex reveals an alternative mode of atp binding to the catalytic site

SCOP Domain Sequences for d1s26c_:

Sequence, based on SEQRES records: (download)

>d1s26c_ e.41.1.1 (C:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksni
efkllykqlnftenetdnfevfqkiid

Sequence, based on observed residues (ATOM records): (download)

>d1s26c_ e.41.1.1 (C:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis}
ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvh
gkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrie
elkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnw
rnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtn
llikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdn
eifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitk
akintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhi
fsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqkfkl
lykqlnftenetdnfevfqkiid

SCOP Domain Coordinates for d1s26c_:

Click to download the PDB-style file with coordinates for d1s26c_.
(The format of our PDB-style files is described here.)

Timeline for d1s26c_: