SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1s20h1 (1s20 H:1-332)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150779Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2150780Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2150781Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 protein domains)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 2150782Protein 2,3-diketogulonate oxidoreductase (YiaK) [89735] (1 species)
  7. 2150783Species Escherichia coli [TaxId:562] [89736] (2 PDB entries)
  8. 2150793Domain d1s20h1: 1s20 H:1-332 [98363]
    Other proteins in same PDB: d1s20a2, d1s20b2, d1s20c2, d1s20d2, d1s20e2, d1s20f2, d1s20g2, d1s20h2
    structural genomics
    complexed with nad, tla

Details for d1s20h1

PDB Entry: 1s20 (more details), 2.2 Å

PDB Description: a novel nad binding protein revealed by the crystal structure of e. coli 2,3-diketogulonate reductase (yiak) northeast structural genomics consortium target er82
PDB Compounds: (H:) Hypothetical oxidoreductase yiaK

SCOPe Domain Sequences for d1s20h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s20h1 c.122.1.1 (H:1-332) 2,3-diketogulonate oxidoreductase (YiaK) {Escherichia coli [TaxId: 562]}
mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
rlpghefttllaenrrngitvddsvwakiqal

SCOPe Domain Coordinates for d1s20h1:

Click to download the PDB-style file with coordinates for d1s20h1.
(The format of our PDB-style files is described here.)

Timeline for d1s20h1: