Lineage for d1s1ra_ (1s1r A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681974Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 681975Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 682098Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 682099Species Human (Homo sapiens) [TaxId:9606] [102052] (10 PDB entries)
  8. 682109Domain d1s1ra_: 1s1r A: [98355]
    complexed with act, mpd, nap

Details for d1s1ra_

PDB Entry: 1s1r (more details), 2 Å

PDB Description: Crystal structures of prostaglandin D2 11-ketoreductase (AKR1C3) in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOP Domain Sequences for d1s1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ra_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypysd

SCOP Domain Coordinates for d1s1ra_:

Click to download the PDB-style file with coordinates for d1s1ra_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ra_: