SCOPe 2.06: Domain d1s1qc_: 1s1q C:

Lineage for d1s1qc_ (1s1q C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (13 PDB entries)

8. Domain d1s1qc_: 1s1q C: [98353]
   Other proteins in same PDB: d1s1qb_, d1s1qd_
   complexed with acy, cu, so4

Details for d1s1qc_

PDB Entry: 1s1q, 2 Å

PDB Description: TSG101(UEV) domain in complex with Ubiquitin

PDB Compounds: (C:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1s1qc_:

Sequence; same for both SEQRES and ATOM records:

>d1s1qc_ d.20.1.2 (C:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
sesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvpy
rgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsd
llgliqvmivvfgdeppvf

Timeline for d1s1qc_:

• d1s1qc_ first appeared in SCOP 1.67
  
• d1s1qc_ appears in SCOPe 2.05
  
• d1s1qc_ appears in SCOPe 2.07
  
• d1s1qc_ appears in the current release, SCOPe 2.08