Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.2: UEV domain [75383] (3 proteins) |
Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries) |
Domain d1s1qc_: 1s1q C: [98353] Other proteins in same PDB: d1s1qb_, d1s1qd_ complexed with acy, cu, so4 |
PDB Entry: 1s1q (more details), 2 Å
SCOPe Domain Sequences for d1s1qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1qc_ d.20.1.2 (C:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} sesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvpy rgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsd llgliqvmivvfgdeppvf
Timeline for d1s1qc_: