| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.2: UEV domain [75383] (3 proteins) |
| Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries) |
| Domain d1s1qa_: 1s1q A: [98351] Other proteins in same PDB: d1s1qb_, d1s1qd_ complexed with acy, cu, so4 |
PDB Entry: 1s1q (more details), 2 Å
SCOPe Domain Sequences for d1s1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfs
Timeline for d1s1qa_: