SCOPe 2.06: Domain d1s1jb_: 1s1j B:

Lineage for d1s1jb_ (1s1j B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold
   automatically mapped to Pfam PF04354

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)

6. Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)

7. Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)

8. Domain d1s1jb_: 1s1j B: [98349]
   complexed with iqz

Details for d1s1jb_

PDB Entry: 1s1j, 2.18 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin inhibitor 1

PDB Compounds: (B:) cell division protein zipa

SCOPe Domain Sequences for d1s1jb_:

Sequence; same for both SEQRES and ATOM records:

>d1s1jb_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
qklreyqdiirevkdana

Timeline for d1s1jb_:

• d1s1jb_ first appeared in SCOP 1.67
  
• d1s1jb_ appears in SCOPe 2.05
  
• d1s1jb_ appears in SCOPe 2.07
  
• d1s1jb_ appears in the current release, SCOPe 2.08