Lineage for d1s1jb_ (1s1j B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431635Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 1431636Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 1431637Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 1431638Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)
  8. 1431643Domain d1s1jb_: 1s1j B: [98349]
    complexed with iqz

Details for d1s1jb_

PDB Entry: 1s1j (more details), 2.18 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin inhibitor 1
PDB Compounds: (B:) cell division protein zipa

SCOPe Domain Sequences for d1s1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1jb_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
qklreyqdiirevkdana

SCOPe Domain Coordinates for d1s1jb_:

Click to download the PDB-style file with coordinates for d1s1jb_.
(The format of our PDB-style files is described here.)

Timeline for d1s1jb_: