Lineage for d1s1ja_ (1s1j A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511149Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
  5. 511150Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)
  6. 511151Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 511152Species Escherichia coli [TaxId:562] [64386] (5 PDB entries)
  8. 511156Domain d1s1ja_: 1s1j A: [98348]

Details for d1s1ja_

PDB Entry: 1s1j (more details), 2.18 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin inhibitor 1

SCOP Domain Sequences for d1s1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ja_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli}
keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
qklreyqdiirevkda

SCOP Domain Coordinates for d1s1ja_:

Click to download the PDB-style file with coordinates for d1s1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ja_: