Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins) |
Protein Potassium channel kv4.3 [102924] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102925] (1 PDB entry) |
Domain d1s1gb1: 1s1g B:38-145 [98347] Other proteins in same PDB: d1s1ga2, d1s1gb2 complexed with zn |
PDB Entry: 1s1g (more details), 2.6 Å
SCOPe Domain Sequences for d1s1gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1gb1 d.42.1.2 (B:38-145) Potassium channel kv4.3 {Human (Homo sapiens) [TaxId: 9606]} qdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnf yrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenle
Timeline for d1s1gb1: