Lineage for d1s1gb1 (1s1g B:38-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945738Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 2945770Protein Potassium channel kv4.3 [102924] (1 species)
  7. 2945771Species Human (Homo sapiens) [TaxId:9606] [102925] (1 PDB entry)
  8. 2945773Domain d1s1gb1: 1s1g B:38-145 [98347]
    Other proteins in same PDB: d1s1ga2, d1s1gb2
    complexed with zn

Details for d1s1gb1

PDB Entry: 1s1g (more details), 2.6 Å

PDB Description: crystal structure of kv4.3 t1 domain
PDB Compounds: (B:) Potassium voltage-gated channel subfamily D member 3

SCOPe Domain Sequences for d1s1gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1gb1 d.42.1.2 (B:38-145) Potassium channel kv4.3 {Human (Homo sapiens) [TaxId: 9606]}
qdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnf
yrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenle

SCOPe Domain Coordinates for d1s1gb1:

Click to download the PDB-style file with coordinates for d1s1gb1.
(The format of our PDB-style files is described here.)

Timeline for d1s1gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1gb2