SCOPe 2.08: Domain d1s1gb1: 1s1g B:38-145

Lineage for d1s1gb1 (1s1g B:38-145)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)

6. Protein Potassium channel kv4.3 [102924] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102925] (1 PDB entry)

8. Domain d1s1gb1: 1s1g B:38-145 [98347]
   Other proteins in same PDB: d1s1ga2, d1s1gb2
   complexed with zn

Details for d1s1gb1

PDB Entry: 1s1g, 2.6 Å

PDB Description: crystal structure of kv4.3 t1 domain

PDB Compounds: (B:) Potassium voltage-gated channel subfamily D member 3

SCOPe Domain Sequences for d1s1gb1:

Sequence; same for both SEQRES and ATOM records:

>d1s1gb1 d.42.1.2 (B:38-145) Potassium channel kv4.3 {Human (Homo sapiens) [TaxId: 9606]}
qdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnf
yrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenle

Timeline for d1s1gb1:

• d1s1gb1 first appeared in SCOP 1.67, called d1s1gb_
  
• d1s1gb1 appears in SCOPe 2.07