Lineage for d1s1ga_ (1s1g A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903421Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 1903453Protein Potassium channel kv4.3 [102924] (1 species)
  7. 1903454Species Human (Homo sapiens) [TaxId:9606] [102925] (1 PDB entry)
  8. 1903455Domain d1s1ga_: 1s1g A: [98346]
    complexed with zn

Details for d1s1ga_

PDB Entry: 1s1g (more details), 2.6 Å

PDB Description: crystal structure of kv4.3 t1 domain
PDB Compounds: (A:) Potassium voltage-gated channel subfamily D member 3

SCOPe Domain Sequences for d1s1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ga_ d.42.1.2 (A:) Potassium channel kv4.3 {Human (Homo sapiens) [TaxId: 9606]}
delivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnfy
rtgklhypryecisayddelafygilpeiigdccyeeykdrkrenle

SCOPe Domain Coordinates for d1s1ga_:

Click to download the PDB-style file with coordinates for d1s1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ga_: