Class b: All beta proteins [48724] (180 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.3: Apyrase [101887] (1 family) distorted propeller with an alpha helix inserted between the second and third blades automatically mapped to Pfam PF06079 |
Family b.67.3.1: Apyrase [101888] (1 protein) Pfam PF06079 |
Protein Soluble calcium-activated nucleotidase SCAN-1 [101889] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101890] (4 PDB entries) |
Domain d1s1da_: 1s1d A: [98344] complexed with act, ca, gp2, so4, trs |
PDB Entry: 1s1d (more details), 1.6 Å
SCOPe Domain Sequences for d1s1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1da_ b.67.3.1 (A:) Soluble calcium-activated nucleotidase SCAN-1 {Human (Homo sapiens) [TaxId: 9606]} nwyndtyplsppqrtpagiryriaviadldtesraqeentwfsylkkgyltlsdsgdkva vewdkdhgvleshlaekgrgmelsdlivfngklysvddrtgvvyqiegskavpwvilsdg dgtvekgfkaewlavkderlyvgglgkewttttgdvvnenpewvkvvgykgsvdhenwvs nynalraaagiqppgylihesacwsdtlqrwfflprrasqerysekdderkganlllsas pdfgdiavshvgavvpthgfssfkfipntddqiivalkseedsgrvasyimaftldgrfl lpetkigsvkyegiefi
Timeline for d1s1da_: