![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.27: G protein-binding domain [103652] (2 families) ![]() |
![]() | Family h.1.27.1: RhoA-binding domain [103653] (1 protein) |
![]() | Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry) |
![]() | Domain d1s1cy1: 1s1c Y:947-1014 [98343] Other proteins in same PDB: d1s1ca_, d1s1cb_, d1s1cx2, d1s1cy2 complexed with gnp, mg |
PDB Entry: 1s1c (more details), 2.6 Å
SCOPe Domain Sequences for d1s1cy1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1cy1 h.1.27.1 (Y:947-1014) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens) [TaxId: 9606]} mltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavnkl aeimnrkd
Timeline for d1s1cy1:
![]() Domains from other chains: (mouse over for more information) d1s1ca_, d1s1cb_, d1s1cx1, d1s1cx2 |