SCOPe 2.01: Domain d1s1cy_: 1s1c Y:

Lineage for d1s1cy_ (1s1c Y:)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.27: G protein-binding domain [103652] (2 families)

5. Family h.1.27.1: RhoA-binding domain [103653] (1 protein)

6. Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry)

8. Domain d1s1cy_: 1s1c Y: [98343]
   Other proteins in same PDB: d1s1ca_, d1s1cb_
   complexed with gnp, mg

Details for d1s1cy_

PDB Entry: 1s1c, 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI

PDB Compounds: (Y:) Rho-associated, coiled-coil containing protein kinase 1

SCOPe Domain Sequences for d1s1cy_:

Sequence; same for both SEQRES and ATOM records:

>d1s1cy_ h.1.27.1 (Y:) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens) [TaxId: 9606]}
gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
klaeimnrkd

Timeline for d1s1cy_:

• d1s1cy_ first appeared in SCOP 1.67
  
• d1s1cy_ appears in SCOP 1.75
  
• d1s1cy_ appears in SCOPe 2.02
  
• d1s1cy_ appears in the current release, SCOPe 2.08, called d1s1cy1