SCOPe 2.08: Domain d1s17b_: 1s17 B:

Lineage for d1s17b_ (1s17 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [75578] (4 PDB entries)

8. Domain d1s17b_: 1s17 B: [98336]
   complexed with gnr, gol, ni

Details for d1s17b_

PDB Entry: 1s17, 1.95 Å

PDB Description: Identification of Novel Potent Bicyclic Peptide Deformylase Inhibitors

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d1s17b_:

Sequence; same for both SEQRES and ATOM records:

>d1s17b_ d.167.1.1 (B:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]}
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhr

Timeline for d1s17b_:

• d1s17b_ first appeared in SCOP 1.67
  
• d1s17b_ appears in SCOPe 2.07