Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins) |
Protein Topoisomerase IV subunit B [102753] (1 species) |
Species Escherichia coli [TaxId:562] [102754] (1 PDB entry) |
Domain d1s16b1: 1s16 B:2217-2383 [98333] Other proteins in same PDB: d1s16a2, d1s16b2 complexed with anp, mg, so4 |
PDB Entry: 1s16 (more details), 2.1 Å
SCOPe Domain Sequences for d1s16b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s16b1 d.14.1.3 (B:2217-2383) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} dglndylaeavnglptlpekpfignfagdteavdwallwlpeggelltesyvnliptmqg gthvnglrqglldamrefceyrnilprgvklsaediwdrcayvlsvkmqdpqfagqtker lssrqcaafvsgvvkdafilwlnqnvqaaellaemaissaqrrmraa
Timeline for d1s16b1: