Lineage for d1s16a2 (1s16 A:1004-1216)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217156Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1217157Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1217381Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 1217414Protein Topoisomerase IV subunit B [103228] (1 species)
  7. 1217415Species Escherichia coli [TaxId:562] [103229] (2 PDB entries)
  8. 1217418Domain d1s16a2: 1s16 A:1004-1216 [98332]
    Other proteins in same PDB: d1s16a1, d1s16b1
    complexed with anp, mg, so4

Details for d1s16a2

PDB Entry: 1s16 (more details), 2.1 Å

PDB Description: Crystal Structure of E. coli Topoisomerase IV ParE 43kDa subunit complexed with ADPNP
PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d1s16a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s16a2 d.122.1.2 (A:1004-1216) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}
tynadaievltglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadq
sleviddgrgmpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnals
krvevnvrrdgqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsr
lthvlkakavlcpgveitfkdeinnteqrwcyq

SCOPe Domain Coordinates for d1s16a2:

Click to download the PDB-style file with coordinates for d1s16a2.
(The format of our PDB-style files is described here.)

Timeline for d1s16a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s16a1