![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) |
![]() | Protein Topoisomerase IV subunit B [103228] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103229] (2 PDB entries) |
![]() | Domain d1s14b_: 1s14 B: [98330] complexed with nov |
PDB Entry: 1s14 (more details), 2 Å
SCOPe Domain Sequences for d1s14b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s14b_ d.122.1.2 (B:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} epvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgmpv dihpeegvpavelilcisvvnalskrvevnvrrdgqvyniafengekvqdlqvvgtcgkr ntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwcyqd
Timeline for d1s14b_: