Lineage for d1s14b_ (1s14 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580324Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2580359Protein Topoisomerase IV subunit B [103228] (1 species)
  7. 2580360Species Escherichia coli [TaxId:562] [103229] (2 PDB entries)
  8. 2580362Domain d1s14b_: 1s14 B: [98330]
    complexed with nov

Details for d1s14b_

PDB Entry: 1s14 (more details), 2 Å

PDB Description: Crystal structure of Escherichia coli Topoisomerase IV ParE 24kDa subunit
PDB Compounds: (B:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d1s14b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s14b_ d.122.1.2 (B:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}
epvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgmpv
dihpeegvpavelilcisvvnalskrvevnvrrdgqvyniafengekvqdlqvvgtcgkr
ntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwcyqd

SCOPe Domain Coordinates for d1s14b_:

Click to download the PDB-style file with coordinates for d1s14b_.
(The format of our PDB-style files is described here.)

Timeline for d1s14b_: