Lineage for d1s0za_ (1s0z A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360318Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 360319Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 360320Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 proteins)
  6. 360568Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 360569Species Human (Homo sapiens) [TaxId:9606] [48529] (5 PDB entries)
  8. 360574Domain d1s0za_: 1s0z A: [98326]
    complexed with eb1

Details for d1s0za_

PDB Entry: 1s0z (more details), 2.5 Å

PDB Description: crystal structure of the vdr lbd complexed to seocalcitol.

SCOP Domain Sequences for d1s0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0za_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens)}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

SCOP Domain Coordinates for d1s0za_:

Click to download the PDB-style file with coordinates for d1s0za_.
(The format of our PDB-style files is described here.)

Timeline for d1s0za_: