Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
Protein Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 [103096] (1 species) forms heterohexamer with alpha-subunit |
Species Pseudomonas pavonaceae [TaxId:47881] [103097] (1 PDB entry) |
Domain d1s0yd_: 1s0y D: [98317] Other proteins in same PDB: d1s0ya_, d1s0yc_, d1s0ye_, d1s0yg_, d1s0yi_, d1s0yk_ complexed with mla |
PDB Entry: 1s0y (more details), 2.3 Å
SCOPe Domain Sequences for d1s0yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0yd_ d.80.1.1 (D:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]} pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgri
Timeline for d1s0yd_: