Lineage for d1s0wc_ (1s0w C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509021Fold d.98: beta-lactamase-inhibitor protein, BLIP [55647] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 509022Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (1 family) (S)
  5. 509023Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (1 protein)
    duplication: consists of two clear structural repeats each having this fold
  6. 509024Protein beta-lactamase-inhibitor protein, BLIP [55650] (1 species)
  7. 509025Species Streptomyces clavuligerus [TaxId:1901] [55651] (2 PDB entries)
  8. 509028Domain d1s0wc_: 1s0w C: [98311]
    Other proteins in same PDB: d1s0wa_, d1s0wb_

Details for d1s0wc_

PDB Entry: 1s0w (more details), 2.3 Å

PDB Description: 1b lactamse/ b lactamase inhibitor

SCOP Domain Sequences for d1s0wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0wc_ d.98.1.1 (C:) beta-lactamase-inhibitor protein, BLIP {Streptomyces clavuligerus}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgayrgsahlwftdgvlqgkrqwdlv

SCOP Domain Coordinates for d1s0wc_:

Click to download the PDB-style file with coordinates for d1s0wc_.
(The format of our PDB-style files is described here.)

Timeline for d1s0wc_: