SCOP 1.69: Domain d1s0wb_: 1s0w B:

Lineage for d1s0wb_ (1s0w B:)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (28 PDB entries)

8. Domain d1s0wb_: 1s0w B: [98310]
   Other proteins in same PDB: d1s0wc_, d1s0wd_

Details for d1s0wb_

PDB Entry: 1s0w, 2.3 Å

PDB Description: 1b lactamse/ b lactamase inhibitor

SCOP Domain Sequences for d1s0wb_:

Sequence; same for both SEQRES and ATOM records:

>d1s0wb_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1s0wb_:

• d1s0wb_ first appeared in SCOP 1.67
  
• d1s0wb_ appears in SCOP 1.71
  
• d1s0wb_ appears in the current release, SCOPe 2.08