SCOPe 2.04: Domain d1s0wa_: 1s0w A:

Lineage for d1s0wa_ (1s0w A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (37 PDB entries)

8. Domain d1s0wa_: 1s0w A: [98309]
   Other proteins in same PDB: d1s0wc_, d1s0wd_
   complexed with ca

Details for d1s0wa_

PDB Entry: 1s0w, 2.3 Å

PDB Description: 1b lactamse/ b lactamase inhibitor

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1s0wa_:

Sequence; same for both SEQRES and ATOM records:

>d1s0wa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1s0wa_:

• d1s0wa_ first appeared in SCOP 1.67
  
• d1s0wa_ appears in SCOPe 2.03
  
• d1s0wa_ appears in SCOPe 2.05
  
• d1s0wa_ appears in the current release, SCOPe 2.08