Lineage for d1s0pb_ (1s0p B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450395Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
    6 helices: bundle; left-handed twist, up-and-down topology
  4. 450396Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family) (S)
  5. 450397Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)
  6. 450398Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)
  7. 450399Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (1 PDB entry)
  8. 450401Domain d1s0pb_: 1s0p B: [98301]

Details for d1s0pb_

PDB Entry: 1s0p (more details), 1.4 Å

PDB Description: Structure of the N-Terminal Domain of the Adenylyl Cyclase-Associated Protein (CAP) from Dictyostelium discoideum.

SCOP Domain Sequences for d1s0pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0pb_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum)}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

SCOP Domain Coordinates for d1s0pb_:

Click to download the PDB-style file with coordinates for d1s0pb_.
(The format of our PDB-style files is described here.)

Timeline for d1s0pb_: