Lineage for d1s0ob2 (1s0o B:1-240)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 518349Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 518350Protein DinB homolog (DBH) [100889] (2 species)
  7. 518356Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (11 PDB entries)
  8. 518361Domain d1s0ob2: 1s0o B:1-240 [98299]
    Other proteins in same PDB: d1s0oa1, d1s0ob1

Details for d1s0ob2

PDB Entry: 1s0o (more details), 2.1 Å

PDB Description: snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift

SCOP Domain Sequences for d1s0ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ob2 e.8.1.7 (B:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d1s0ob2:

Click to download the PDB-style file with coordinates for d1s0ob2.
(The format of our PDB-style files is described here.)

Timeline for d1s0ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s0ob1