Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (2 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
Protein DinB homolog (DBH) [100889] (2 species) |
Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (11 PDB entries) |
Domain d1s0ob2: 1s0o B:1-240 [98299] Other proteins in same PDB: d1s0oa1, d1s0ob1 complexed with ca, mg, ttp |
PDB Entry: 1s0o (more details), 2.1 Å
SCOP Domain Sequences for d1s0ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ob2 e.8.1.7 (B:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV} mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d1s0ob2: