SCOP 1.73: Domain d1s0ob1: 1s0o B:241-341

Lineage for d1s0ob1 (1s0o B:241-341)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (2 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (41 PDB entries)

8. Domain d1s0ob1: 1s0o B:241-341 [98298]
   Other proteins in same PDB: d1s0oa2, d1s0ob2
   complexed with ca, mg, ttp

Details for d1s0ob1

PDB Entry: 1s0o, 2.1 Å

PDB Description: snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift

PDB Compounds: (B:) DNA polymerase IV

SCOP Domain Sequences for d1s0ob1:

Sequence; same for both SEQRES and ATOM records:

>d1s0ob1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d1s0ob1:

• d1s0ob1 first appeared in SCOP 1.67
  
• d1s0ob1 appears in SCOP 1.71
  
• d1s0ob1 appears in SCOP 1.75
  
• d1s0ob1 appears in the current release, SCOPe 2.08