SCOPe 2.07: Domain d1s0oa1: 1s0o A:241-341

Lineage for d1s0oa1 (1s0o A:241-341)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d1s0oa1: 1s0o A:241-341 [98296]
   Other proteins in same PDB: d1s0oa2, d1s0ob2
   protein/DNA complex; complexed with ca, mg, ttp

Details for d1s0oa1

PDB Entry: 1s0o, 2.1 Å

PDB Description: snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d1s0oa1:

Sequence; same for both SEQRES and ATOM records:

>d1s0oa1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d1s0oa1:

• d1s0oa1 first appeared in SCOP 1.67
  
• d1s0oa1 appears in SCOPe 2.06
  
• d1s0oa1 appears in the current release, SCOPe 2.08