Lineage for d1s0oa1 (1s0o A:241-341)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516579Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 516580Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 516581Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 516582Protein DinB homolog (DBH) [100881] (2 species)
  7. 516587Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)
  8. 516591Domain d1s0oa1: 1s0o A:241-341 [98296]
    Other proteins in same PDB: d1s0oa2, d1s0ob2

Details for d1s0oa1

PDB Entry: 1s0o (more details), 2.1 Å

PDB Description: snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift

SCOP Domain Sequences for d1s0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0oa1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1s0oa1:

Click to download the PDB-style file with coordinates for d1s0oa1.
(The format of our PDB-style files is described here.)

Timeline for d1s0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s0oa2