SCOPe 2.07: Domain d1s0na2: 1s0n A:1-240

Lineage for d1s0na2 (1s0n A:1-240)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)

8. Domain d1s0na2: 1s0n A:1-240 [98295]
   Other proteins in same PDB: d1s0na1
   protein/DNA complex; complexed with ca, dcp

Details for d1s0na2

PDB Entry: 1s0n, 2.8 Å

PDB Description: snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d1s0na2:

Sequence; same for both SEQRES and ATOM records:

>d1s0na2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d1s0na2:

• d1s0na2 first appeared in SCOP 1.67
  
• d1s0na2 appears in SCOPe 2.06
  
• d1s0na2 appears in the current release, SCOPe 2.08