Lineage for d1s0mb1 (1s0m B:241-341)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616690Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 616691Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 616692Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 616693Protein DinB homolog (DBH) [100881] (2 species)
  7. 616698Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)
  8. 616715Domain d1s0mb1: 1s0m B:241-341 [98292]
    Other proteins in same PDB: d1s0ma2, d1s0mb2
    complexed with atp, bpa, ca, mg

Details for d1s0mb1

PDB Entry: 1s0m (more details), 2.7 Å

PDB Description: crystal structure of a benzo[a]pyrene diol epoxide adduct in a ternary complex with a dna polymerase

SCOP Domain Sequences for d1s0mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0mb1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1s0mb1:

Click to download the PDB-style file with coordinates for d1s0mb1.
(The format of our PDB-style files is described here.)

Timeline for d1s0mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s0mb2